Iright
BRAND / VENDOR: Proteintech

Proteintech, 13714-1-AP, DMC1 Polyclonal antibody

CATALOG NUMBER: 13714-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DMC1 (13714-1-AP) by Proteintech is a Polyclonal antibody targeting DMC1 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 13714-1-AP targets DMC1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, human testis tissue, rat testis tissue Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)-P: IF-P : 1:600-1:2400 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4653 Product name: Recombinant human DMC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC035658 Sequence: MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTL Predict reactive species Full Name: DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast) Calculated Molecular Weight: 165 aa, 18 kDa, 38 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC035658 Gene Symbol: DMC1 Gene ID (NCBI): 11144 RRID: AB_2091076 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14565 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924