Iright
BRAND / VENDOR: Proteintech

Proteintech, 13722-1-AP, TTF2 Polyclonal antibody

CATALOG NUMBER: 13722-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TTF2 (13722-1-AP) by Proteintech is a Polyclonal antibody targeting TTF2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13722-1-AP targets TTF2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A2780 cells, HeLa cells, Jurkat cells Positive IP detected in: A2780 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Transcription elongation is an key target for control of eukaryotic gene expression. After initiating from a promoter, the RNA polymerase II elongation complex is subjected to a block to elongation by the action of components of N-TEF (negative transcription elongation factor) [PMID: 9748214]. Transcription termination factor 2 (TTF2) is a DsDNA-dependent ATPase that acts as a transcription termination factor by coupling ATP hydrolysis with removal of RNA polymerase II from the DNA template. It also contribute to mitotic transcription repression, and involved in pre-mRNA splicing[PMID:15125840, 12927788]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4671 Product name: Recombinant human TTF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC030058 Sequence: MEEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFKVLDKNQEPALWKQLIKGEGEEKKADKKQREKGDQLFDQKKEQKPEMMEKDLSSGLVPKKKQSVVQEKKQEEGAEIQCEAETGGTHKRDFSEIKSQQCQGNELTRPSASSQEKSSGKSQDVQRESEPLREKVTQLLPQNVHSHNSISKPQKGGPLNKEYTNWEAKETKAKDGPS Predict reactive species Full Name: transcription termination factor, RNA polymerase II Calculated Molecular Weight: 1162 aa, 129 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC030058 Gene Symbol: TTF2 Gene ID (NCBI): 8458 RRID: AB_2262865 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNY4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924