Proteintech, 13725-1-AP, CBR4 Polyclonal antibody

Size: 20ul / 150ul The CBR4 (13725-1-AP) by Proteintech is a Polyclonal antibody targeting CBR4 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13725-1-AP targets CBR4 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells, HepG2 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4678 Product name: Recombinant human CBR4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC033650 Sequence: MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAH Predict reactive species Full Name: carbonyl reductase 4 Calculated Molecular Weight: 237 aa, 25 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC033650 Gene Symbol: CBR4 Gene ID (NCBI): 84869 RRID: AB_10643240 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N4T8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.