Iright
BRAND / VENDOR: Proteintech

Proteintech, 13736-1-AP, CA14 Polyclonal antibody

CATALOG NUMBER: 13736-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CA14 (13736-1-AP) by Proteintech is a Polyclonal antibody targeting CA14 in WB, ELISA applications with reactivity to human, mouse samples 13736-1-AP targets CA14 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse eye tissue, mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Carbonic anhydrase XIV (CAXIV, Car14) is highly expressed in the hepatocyte with predominance in the canalicular membrane and its active site in the extracellular milieu. The CA XIV isoform may also be of importance for regulation of neuronal excitability and transport processes in brain. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4673 Product name: Recombinant human CA14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-293 aa of BC034412 Sequence: GQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSL Predict reactive species Full Name: carbonic anhydrase XIV Calculated Molecular Weight: 337 aa, 38 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC034412 Gene Symbol: CA14 Gene ID (NCBI): 23632 RRID: AB_2065836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924