Proteintech, 13774-1-AP, PCP2 Polyclonal antibody

Size: 20ul / 150ul The PCP2 (13774-1-AP) by Proteintech is a Polyclonal antibody targeting PCP2 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 13774-1-AP targets PCP2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse cerebellum tissue, mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Pcp2 is uniquely expressed in cerebellar Purkinje cells and in retinal bipolar neurons, and it may function as a cell-type specific modulator for G protein-mediated cell signaling. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4759 Product name: Recombinant human PCP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC038715 Sequence: MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP Predict reactive species Full Name: Purkinje cell protein 2 Calculated Molecular Weight: 136 aa, 15 kDa GenBank Accession Number: BC038715 Gene Symbol: PCP2 Gene ID (NCBI): 126006 RRID: AB_2935435 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.