Proteintech, 13783-1-AP, PFN2 Polyclonal antibody

Size: 20ul / 150ul The PFN2 (13783-1-AP) by Proteintech is a Polyclonal antibody targeting PFN2 in WB, ELISA applications with reactivity to human samples 13783-1-AP targets PFN2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, SH-SY5Y cells, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information PFN2 (profilin 2) is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. The MW of this protein is 15 kDa. Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4792 Product name: Recombinant human PFN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC018049 Sequence: MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF Predict reactive species Full Name: profilin 2 Calculated Molecular Weight: 140 aa, 15 kDa Observed Molecular Weight: 14-15 kDa GenBank Accession Number: BC018049 Gene Symbol: PFN2 Gene ID (NCBI): 5217 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35080 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.