Iright
BRAND / VENDOR: Proteintech

Proteintech, 13785-1-AP, PDE1C Polyclonal antibody

CATALOG NUMBER: 13785-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PDE1C (13785-1-AP) by Proteintech is a Polyclonal antibody targeting PDE1C in WB, IP, ELISA applications with reactivity to human, mouse samples 13785-1-AP targets PDE1C in WB, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human heart tissue Positive IP detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. PDE1C, is calmodulin-dependent PDEs (CaM-PDEs) that are stimulated by a calcium-calmodulin complex. Expression of PDE1C may be an important component in signal transduction pathways mediated by calcium that permit cell cycle traverse and proliferation(PMID:9366577). It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4798 Product name: Recombinant human PDE1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 284-634 aa of BC022525 Sequence: RSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKARMAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGKNKTDKKDHSNIGNDSKKTDDSQE Predict reactive species Full Name: phosphodiesterase 1C, calmodulin-dependent 70kDa Calculated Molecular Weight: 634 aa, 72 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC022525 Gene Symbol: PDE1C Gene ID (NCBI): 5137 RRID: AB_2268145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14123 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924