Proteintech, 13808-1-AP, DYNC1I1 Polyclonal antibody

Size: 20ul / 150ul The DYNC1I1 (13808-1-AP) by Proteintech is a Polyclonal antibody targeting DYNC1I1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13808-1-AP targets DYNC1I1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U-87 MG cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4810 Product name: Recombinant human DYNC1I1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 276-625 aa of BC022540 Sequence: SLQYPELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSLDMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLCTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEGRIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA Predict reactive species Full Name: dynein, cytoplasmic 1, intermediate chain 1 Calculated Molecular Weight: 645 aa, 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC022540 Gene Symbol: DYNC1I1 Gene ID (NCBI): 1780 RRID: AB_2093492 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14576 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.