Iright
BRAND / VENDOR: Proteintech

Proteintech, 13818-1-AP, Septin 7 Polyclonal antibody

CATALOG NUMBER: 13818-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Septin 7 (13818-1-AP) by Proteintech is a Polyclonal antibody targeting Septin 7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13818-1-AP targets Septin 7 in WB, IHC, IF/ICC, CoIP, ELISA, PLA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells, HepG2 cells, Jurkat cells, rat testis tissue, mouse testis tissue Positive IHC detected in: human gliomas tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Septins (SEPTs) are members of a conserved family of cytoskeletal GTPases involved in various cellular processes, including cytoskeleton organization, cytokinesis, and membrane dynamics. SEPT7 is a unique septin required for filament formation. It has also been reported to be involved in migration and invasion in various cancer cells, including breast cancer and glioma. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4907 Product name: Recombinant human SEPT7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-417 aa of BC025987 Sequence: VIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF Predict reactive species Full Name: septin 7 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC025987 Gene Symbol: Septin 7 Gene ID (NCBI): 989 RRID: AB_2254298 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16181 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924