Iright
BRAND / VENDOR: Proteintech

Proteintech, 13822-1-AP, ARP3/ARP3B Polyclonal antibody

CATALOG NUMBER: 13822-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ARP3/ARP3B (13822-1-AP) by Proteintech is a Polyclonal antibody targeting ARP3/ARP3B in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13822-1-AP targets ARP3/ARP3B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse spleen tissue, human liver tissue, A549 cells, HL-60 cells, HeLa cells, Jurkat cells, K-562 cells, PC-3 cells Positive IP detected in: mouse spleen tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information ARP3 (also known as ACTR3) is a major constituent of the ARP2/3 complex that is necessary for nucleating actin polymerization at filament branches. ARP3 localizes to the lamellipodia of stationary and locomoting fibroblasts. Overexpression of ARP3 has been reported in several types of cancer cells. This antibody recognizes endogenous ARP3 and may cross-react with ATCR3B. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4922 Product name: Recombinant human ACTR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-418 aa of BC044590 Sequence: RQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS Predict reactive species Full Name: ARP3 actin-related protein 3 homolog (yeast) Calculated Molecular Weight: 418 aa 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC044590 Gene Symbol: ARP3/ACTR3 Gene ID (NCBI): 10096 RRID: AB_2221967 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61158 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924