Proteintech, 13826-1-AP, CYP4V2 Polyclonal antibody

Size: 20ul / 150ul The CYP4V2 (13826-1-AP) by Proteintech is a Polyclonal antibody targeting CYP4V2 in WB, ELISA applications with reactivity to human, mouse samples 13826-1-AP targets CYP4V2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information A cytochrome P450 monooxygenase involved in fatty acid metabolism in the eye. Catalyzes the omega-hydroxylation of polyunsaturated fatty acids (PUFAs) docosahexaenoate (DHA) and its precursor eicosapentaenoate (EPA), and may contribute to the homeostasis of these retinal PUFAs (PMID: 22772592). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4952 Product name: Recombinant human CYP4V2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-525 aa of BC060857 Sequence: EQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLKILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER Predict reactive species Full Name: cytochrome P450, family 4, subfamily V, polypeptide 2 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC060857 Gene Symbol: CYP4V2 Gene ID (NCBI): 285440 RRID: AB_3669171 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZWL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.