Proteintech, 13835-1-AP, SLITRK4 Polyclonal antibody

Size: 20ul / 150ul The SLITRK4 (13835-1-AP) by Proteintech is a Polyclonal antibody targeting SLITRK4 in WB, ELISA applications with reactivity to human, mouse, rat samples 13835-1-AP targets SLITRK4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4781 Product name: Recombinant human SLITRK4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 33-355 aa of BC040986 Sequence: VSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDL Predict reactive species Full Name: SLIT and NTRK-like family, member 4 Calculated Molecular Weight: 837 aa, 94 kDa Observed Molecular Weight: 96 kDa GenBank Accession Number: BC040986 Gene Symbol: SLITRK4 Gene ID (NCBI): 139065 RRID: AB_2190333 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IW52 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.