Proteintech, 13845-1-AP, LRRC4C Polyclonal antibody

Size: 20ul / 150ul The LRRC4C (13845-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC4C in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13845-1-AP targets LRRC4C in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Y79 cells Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4811 Product name: Recombinant human LRRC4C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-351 aa of BC041374 Sequence: QTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTC Predict reactive species Full Name: leucine rich repeat containing 4C Calculated Molecular Weight: 640 aa, 72 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC041374 Gene Symbol: LRRC4C Gene ID (NCBI): 57689 RRID: AB_2137623 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCJ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.