Product Description
Size: 20ul / 150ul
The SLC2A13 (13848-1-AP) by Proteintech is a Polyclonal antibody targeting SLC2A13 in WB, ELISA applications with reactivity to human, mouse, pig samples
13848-1-AP targets SLC2A13 in WB, ELISA applications and shows reactivity with human, mouse, pig samples.
Tested Applications
Positive WB detected in: mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Background Information
HMIT is a glycosylated protein containing three conserved internalization signals: an ER retention signal and a dileucine internalization signal in the N-terminal region and a tyrosine-based internalization motif at the C-terminus.
Specification
Tested Reactivity: human, mouse, pig
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag4818 Product name: Recombinant human SLC2A13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 243-338 aa of BC047507 Sequence: SPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYVFLSGFLLKRL Predict reactive species
Full Name: solute carrier family 2 (facilitated glucose transporter), member 13
Calculated Molecular Weight: 629 aa, 70 kDa
Observed Molecular Weight: 75~90 kDa
GenBank Accession Number: BC047507
Gene Symbol: SLC2A13
Gene ID (NCBI): 114134
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96QE2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924