Proteintech, 13859-1-AP, TIMM44 Polyclonal antibody

Size: 20ul / 150ul The TIMM44 (13859-1-AP) by Proteintech is a Polyclonal antibody targeting TIMM44 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13859-1-AP targets TIMM44 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Neuro-2a cells, C6 cells, Jurkat cells Positive IP detected in: HeLa cells, mouse heart tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Translocase of inner mitochondrial membrane 44 (TIMM44), also known as MIMT44 and TIM44, belongs to the Tim44 family. TIMM44 is a mitochondrial protein located at the inner mitochondrial membrane, which is crucial for the integrity and function of mitochondria. In an ATP-dependent manner, TIMM44 anchors mitochondrial heat shock protein 70 to the translocase of the mitochondrial inner membrane 23 (TIMM23) complex. TIMM44 is essential for mitochondrial pre-protein import into the mitochondrial matrix. TIMM44 is vital for the integrity and function of mitochondria. TIMM44 silencing disrupted mitochondrial functions in endothelial cells, causing mitochondrial protein input arrest, ATP reduction, ROS production, and mitochondrial depolarization, and leading to apoptosis activation (PMID: 36438483, PMID: 37147302, PMID: 38467612). The observed molecular weight of TIMM44 is 45 kDa, indicating a mature form of TIMM44 (PMID: 33891006). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4834 Product name: Recombinant human TIMM44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 153-452 aa of BC033628 Sequence: AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL Predict reactive species Full Name: translocase of inner mitochondrial membrane 44 homolog (yeast) Calculated Molecular Weight: 452 aa, 51 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC033628 Gene Symbol: TIMM44 Gene ID (NCBI): 10469 RRID: AB_2204679 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43615 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.