Proteintech, 13876-1-AP, Desmocollin 2 Polyclonal antibody

Size: 20ul / 150ul The Desmocollin 2 (13876-1-AP) by Proteintech is a Polyclonal antibody targeting Desmocollin 2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 13876-1-AP targets Desmocollin 2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, HepG2 cells Positive IHC detected in: human oesophagus tissue, human skin cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Desmocollin 2 (DSC2) is a member of the desmocollin subfamily of the cadherin superfamily. The desmocollins (DSC1-3), along with the desmogleins (DSG1-4), are found primarily in epithelial and cardiac muscle where they constitute the adhesive proteins of the intercellular desmosome junctions and are required for cell adhesion and desmosome formation. Mutations in the DSC2 gene are associated with arrhythmogenic right ventricular dysplasia-11. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4956 Product name: Recombinant human DSC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-357 aa of BC063291 Sequence: LIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTR Predict reactive species Full Name: desmocollin 2 Calculated Molecular Weight: 100 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC063291 Gene Symbol: Desmocollin 2 Gene ID (NCBI): 1824 RRID: AB_2877983 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02487 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.