Iright
BRAND / VENDOR: Proteintech

Proteintech, 13886-1-AP, SIAH1 Polyclonal antibody

CATALOG NUMBER: 13886-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SIAH1 (13886-1-AP) by Proteintech is a Polyclonal antibody targeting SIAH1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 13886-1-AP targets SIAH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, COLO 320 cells, HepG2 cells, Jurkat cells, mouse small intestine tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SIAH1, also named as HUMSIAH, Siah-1a and Siah-1S(21kd), belongs to the SINA (Seven in absentia) family. SIAH1 is known to cause indirect degradation of beta-catenin through formation of a complex with Siah-interacting protein (SIP), Skp1 and Ebi. SIAH1 can form heterodimer or homodimer such as Siah-1*Siah-1(70 or 62kd), Siah-1*Siah-1S(42kd) and Siah-1S*Siah-1S(51-56kd). Importantly, results from in vitro soft agar assay demonstrated that Siah-1S displays a promotion effect on cells tumorigenicity. (PMID:17420721) Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4336 Product name: Recombinant human SIAH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-282 aa of BC035562 Sequence: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC Predict reactive species Full Name: seven in absentia homolog 1 (Drosophila) Calculated Molecular Weight: 282 aa, 31 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC035562 Gene Symbol: SIAH1 Gene ID (NCBI): 6477 RRID: AB_10643374 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUQ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924