Iright
BRAND / VENDOR: Proteintech

Proteintech, 13891-1-AP, NDUFAF2 Polyclonal antibody

CATALOG NUMBER: 13891-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NDUFAF2 (13891-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFAF2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 13891-1-AP targets NDUFAF2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells Positive IP detected in: SH-SY5Y cells Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Mimitin, also named as MMTN, B17.2L, NDUFAF2 and NDUFA12L, is a small mitochondrial protein upregulated by proinflammatory cytokines at the transcriptional and protein levels. It is reported as a possible chaperone for assembly of mitochondrial complex I. The MW of Mimitin is 17-25 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4853 Product name: Recombinant human NDUFAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC033965 Sequence: MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 Calculated Molecular Weight: 169 aa, 20 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC033965 Gene Symbol: NDUFAF2 Gene ID (NCBI): 91942 RRID: AB_10597105 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N183 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924