Iright
BRAND / VENDOR: Proteintech

Proteintech, 13895-1-AP, D2HGDH Polyclonal antibody

CATALOG NUMBER: 13895-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The D2HGDH (13895-1-AP) by Proteintech is a Polyclonal antibody targeting D2HGDH in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13895-1-AP targets D2HGDH in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, human liver tissue, human heart tissue, rat liver tissue, mouse liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information D2HGDH(D-2-hydroxyglutarate dehydrogenase, mitochondrial) is also named as D2HGD and belongs to the FAD-binding oxidoreductase/transferase type 4 family.It catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate.Defects in D2HGDH are the cause of D-2-hydroxyglutaric aciduria type 1 (D2HGA1).It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4857 Product name: Recombinant human D2HGDH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-286 aa of BC036604 Sequence: MLPRRPLAWPAWLLRGAPGAAGSWGRPVGPLARRGCCSAPGTPEVPLTRERYPVQRLPFSTVSKQDLAAFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGILVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVNVAFLGC Predict reactive species Full Name: D-2-hydroxyglutarate dehydrogenase Calculated Molecular Weight: 521 aa, 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC036604 Gene Symbol: D2HGDH Gene ID (NCBI): 728294 RRID: AB_2089330 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N465 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924