Product Description
Size: 20ul / 150ul
The MDP-1 (13929-1-AP) by Proteintech is a Polyclonal antibody targeting MDP-1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
13929-1-AP targets MDP-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: RAW 264.7 cells, HepG2 cells
Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag4949 Product name: Recombinant human MDP-1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC046912 Sequence: MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRCYLHSHPEWNESSNSKSRVRDICEGPNWAFEVQP Predict reactive species
Full Name: magnesium-dependent phosphatase 1
Calculated Molecular Weight: 14 kDa
Observed Molecular Weight: 14 kDa
GenBank Accession Number: BC046912
Gene Symbol: MDP-1
Gene ID (NCBI): 145553
RRID: AB_2877989
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q86V88
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924