Iright
BRAND / VENDOR: Proteintech

Proteintech, 13931-1-AP, Carbonic Anhydrase 4/CA4 Polyclonal antibody

CATALOG NUMBER: 13931-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Carbonic Anhydrase 4/CA4 (13931-1-AP) by Proteintech is a Polyclonal antibody targeting Carbonic Anhydrase 4/CA4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13931-1-AP targets Carbonic Anhydrase 4/CA4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CA4(Carbonic anhydrase 4) is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressing on the luminal surfaces of pulmonary, chorionic (and certain other) capillaries and of proximal renal tubules. It plays a critical role by maintaining the pH in the outer retina, which is important for the normal function of photoreceptors. This protein belongs to the alpha-carbonic anhydrase family. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4960 Product name: Recombinant human CA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-284 aa of BC057792 Sequence: ASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKS Predict reactive species Full Name: carbonic anhydrase IV Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC057792 Gene Symbol: CA4 Gene ID (NCBI): 762 RRID: AB_2877990 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22748 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924