Proteintech, 13963-1-AP, KPNA5 Polyclonal antibody

Size: 20ul / 150ul The KPNA5 (13963-1-AP) by Proteintech is a Polyclonal antibody targeting KPNA5 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 13963-1-AP targets KPNA5 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4920 Product name: Recombinant human KPNA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-231 aa of BC047409 Sequence: MDAMASPGKDNYRMKSYKNKALNPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVPIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTR Predict reactive species Full Name: karyopherin alpha 5 (importin alpha 6) Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC047409 Gene Symbol: KPNA5 Gene ID (NCBI): 3841 RRID: AB_2133847 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15131 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.