Proteintech, 13967-1-AP, IFT88 Polyclonal antibody

Size: 20ul / 150ul The IFT88 (13967-1-AP) by Proteintech is a Polyclonal antibody targeting IFT88 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, canine samples 13967-1-AP targets IFT88 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples. Tested Applications Positive WB detected in: HEK-293 cells, NIH/3T3 cell, MDCK cells, mouse thymus tissue Positive IP detected in: knockout cells and WT cells, HEK-293 cells Positive IHC detected in: mouse heart tissue, human pancreas tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: hTERT-RPE1 cells, MDCK cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT88 (intraflagellar transport protein 88; also known as TG737 or TTC10) is a component of IFT particles and required for cilium biogenesis. Defects in IFT88/Tg737 lead to polycystic kidney disease (11062270). IFT88 localizes to spindle poles during mitosis and is required for spindle orientation in mitosis (21441926). This antibody was raised against the C-terminal region of human IFT88 and can detect the endogenous level of IFT88. Specification Tested Reactivity: human, mouse, rat, canine Cited Reactivity: human, mouse, rat, pig, canine, chicken, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4980 Product name: Recombinant human IFT88 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 532-833 aa of BC030776 Sequence: NIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDRGGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE Predict reactive species Full Name: intraflagellar transport 88 homolog (Chlamydomonas) Calculated Molecular Weight: 94 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC030776 Gene Symbol: IFT88 Gene ID (NCBI): 8100 RRID: AB_2121979 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13099 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.