Proteintech, 13977-1-AP, YES1 Polyclonal antibody

Size: 20ul / 150ul The YES1 (13977-1-AP) by Proteintech is a Polyclonal antibody targeting YES1 in IP, IHC, ELISA applications with reactivity to human samples 13977-1-AP targets YES1 in IP, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: A431 cells Positive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information YES1, also named as p61-Yes and YES, belongs to the protein kinase superfamily, Tyr protein kinase family and SRC subfamily. It promotes infectivity of Neisseria gonorrhoeae in epithelial cells by phosphorylating MCP/CD46. YES1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5016 Product name: Recombinant human YES1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 275-526 aa of BC048960 Sequence: ESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFL Predict reactive species Full Name: v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC048960 Gene Symbol: YES1 Gene ID (NCBI): 7525 RRID: AB_2877998 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07947 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.