Iright
BRAND / VENDOR: Proteintech

Proteintech, 13980-1-AP, YAF2 Polyclonal antibody

CATALOG NUMBER: 13980-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The YAF2 (13980-1-AP) by Proteintech is a Polyclonal antibody targeting YAF2 in IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 13980-1-AP targets YAF2 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: HeLa cells, Jurkat cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, HeLa cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information YY1-associated factor 2 (YAF2) is the binding molecule of Yin-Yang-1 (YY-1) protein and plays an important role in transcriptional regulation. YAF-2 mRNA expression was the highest in heart and skeletal muscle (PMID: 11953439). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5023 Product name: Recombinant human YAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC037777 Sequence: MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRSTLFEVIVSASRTKEPLKFPISGRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH Predict reactive species Full Name: YY1 associated factor 2 Calculated Molecular Weight: 204 aa, 23 kDa Observed Molecular Weight: 20-30 kDa GenBank Accession Number: BC037777 Gene Symbol: YAF2 Gene ID (NCBI): 10138 RRID: AB_3669173 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IY57 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924