Iright
BRAND / VENDOR: Proteintech

Proteintech, 13981-1-AP, IGFBP1 Polyclonal antibody

CATALOG NUMBER: 13981-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IGFBP1 (13981-1-AP) by Proteintech is a Polyclonal antibody targeting IGFBP1 in WB, IHC, ELISA applications with reactivity to human samples 13981-1-AP targets IGFBP1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, human placenta Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information IGF-binding proteins (IGFBPs) family contains members like IGFBP-1, -2, -3, -4,-5 and-6. IGFBPs prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. IGF-I physically interacts with IGFBP-1 and that IGFBP-1 also binds to an integrin receptor, but the effect of IGFBP-1 on cell migration may be independent of IGF-I and is probably mediated through the alpha 5 beta 1 integrin. Transgenic mice models demonstrated that IGFBPs played important roles in the pathogenesis of obesity and INS resistance. Studies conducted in humans demonstrated the close relation between IGFBPs and the components of the metabolic syndrome. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5026 Product name: Recombinant human IGFBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 81-259 aa of BC057806 Sequence: GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSIPWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN Predict reactive species Full Name: IGF binding protein 1 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28-35 kDa GenBank Accession Number: BC057806 Gene Symbol: IGFBP1 Gene ID (NCBI): 3484 RRID: AB_2233481 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08833 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924