Proteintech, 13988-1-AP, 4EBP1 Polyclonal antibody

Size: 20ul / 150ul The 4EBP1 (13988-1-AP) by Proteintech is a Polyclonal antibody targeting 4EBP1 in WB, IHC, ELISA applications with reactivity to human samples 13988-1-AP targets 4EBP1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, K-562 cells, HL-60 cells, HeLa cells, HepG2 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Eukaryotic translation initiation factor 4E-binding protein 1(4EBP1), is a member of 4EBPs family, which regulate the translation of a subset of mRNA by competing with eIF4G for binding to eIF4E, thus preventing the assembly of the eIF4F complex. The eIF4F facilitates the recruitment of other translation initiation factors to form the complex and then initiates cap-dependent translation.4EBP1 also mediates the regulation of protein translation by growth factors, hormones and other stimuli that signal through the MAP kinase and mTORC1 pathways. There are three forms of 4EBP1, alpha, beta and gamma.typical pattern seen on Western blots for phosphorylated heat-acid stabled protein 4EBP1 from rat gastrocnemius muscle. Three distinct bands are noted, with the most rapidly migrating band having an apparent molecular mass of ; 20 kDa and the slowest migrating band of; 24 kDa. The 3 bands are designated by convention asalpha, beta and gamma. (PMID: 10913029) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5056 Product name: Recombinant human 4EBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC004459 Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Predict reactive species Full Name: eukaryotic translation initiation factor 4E binding protein 1 Calculated Molecular Weight: 118 aa, 12 kDa Observed Molecular Weight: 15-24 kDa GenBank Accession Number: BC004459 Gene Symbol: EIF4EBP1 Gene ID (NCBI): 1978 RRID: AB_3669174 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13541 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.