Proteintech, 13990-1-AP, GRK2 Polyclonal antibody

Size: 20ul / 150ul The GRK2 (13990-1-AP) by Proteintech is a Polyclonal antibody targeting GRK2 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human samples 13990-1-AP targets GRK2 in WB, IHC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, Jurkat cells Positive IP detected in: HL-60 cells Positive IHC detected in: human lymphoma tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information GRK2 (G-protein coupled receptor kinase 2) is also named as ADRBK1 (Beta-adrenergic receptor kinase 1), BARK, and BARK1. G-protein-coupled receptors (GPCRs) transmit extracellular signals across the cell membrane. GPCR kinases (GRKs) desensitize GPCR signals in the cell membrane. GRK2 translocation from the cytoplasm to the cell membrane in response to extracellular signals is critical to the function of the protein, where GRK phosphorylation is an important component of its translocation to the membrane.(PMID:27412951) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5071 Product name: Recombinant human ADRBK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 390-689 aa of BC037963 Sequence: PFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL Predict reactive species Full Name: adrenergic, beta, receptor kinase 1 Calculated Molecular Weight: 689 aa, 80 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC037963 Gene Symbol: ADRBK1 Gene ID (NCBI): 156 RRID: AB_2225833 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25098 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.