Iright
BRAND / VENDOR: Proteintech

Proteintech, 14015-1-AP, STAG1 Polyclonal antibody

CATALOG NUMBER: 14015-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STAG1 (14015-1-AP) by Proteintech is a Polyclonal antibody targeting STAG1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 14015-1-AP targets STAG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, human heart tissue, Raji cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:1000 Background Information STAG1, also named as SCC3 homolog 1, is a 1258 amino acid protein, which belongs to the SCC3 family. STAG1 interacts directly with RAD21 in cohesin complex and localizes in nucleus. STAG1 is a Component of cohesin complex, which is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. The calculate molecular weight of STAG1 is 144 kDa, but modified STAG1 is about 145-150 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5123 Product name: Recombinant human STAG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 880-1221 aa of BC064699 Sequence: IVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTSTVLRENSRPMGDQIQEPESEHGSEPDFLHNRGLMEEDAEPIFEDVMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF Predict reactive species Full Name: stromal antigen 1 Calculated Molecular Weight: 144 kDa Observed Molecular Weight: 155 kDa GenBank Accession Number: BC064699 Gene Symbol: STAG1 Gene ID (NCBI): 10274 RRID: AB_2194759 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVM7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924