Iright
BRAND / VENDOR: Proteintech

Proteintech, 14017-1-AP, ESRRG Polyclonal antibody

CATALOG NUMBER: 14017-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ESRRG (14017-1-AP) by Proteintech is a Polyclonal antibody targeting ESRRG in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14017-1-AP targets ESRRG in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human spleen tissue, human kidney tissue Positive IHC detected in: rat stomach tissue, mouse brain tissue, mouse heart tissue, rat brain tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Background Information Estrogen-related receptor gamma (ERR-gamma), also known as NR3B3 (nuclear receptor subfamily 3, group B, member 3), is a member of nuclear hormone receptor family of steroid hormone receptors. As an orphan nuclear receptor, it binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements. It behaves as a constitutive activator of transcription. 4-hydroxytamoxifen and diethylstilbestrol may act as inverse agonists and deactivate ESRRG. It also seems to be the target of bisphenol A. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human ESRRG. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5127 Product name: Recombinant human ESRRG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 94-442 aa of BC064700 Sequence: EYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPLLWSDPADNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV Predict reactive species Full Name: estrogen-related receptor gamma Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC064700 Gene Symbol: ESRRG Gene ID (NCBI): 2104 RRID: AB_2100272 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62508 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924