Iright
BRAND / VENDOR: Proteintech

Proteintech, 14021-1-AP, AADACL1 Polyclonal antibody

CATALOG NUMBER: 14021-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AADACL1 (14021-1-AP) by Proteintech is a Polyclonal antibody targeting AADACL1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14021-1-AP targets AADACL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells Positive IP detected in: COLO 320 cells Positive IHC detected in: human brain tissue, human kidney tissue, human lung tissue, human ovary tissue, human skin tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information AADACL1(Arylacetamide deacetylase-like 1) is also named as NCEH1, KIAA1363 and belongs to the 'GDXG' lipolytic enzyme family. The transmembrane enzyme, AADACL1, controls the production of the monoalkylglycerol ether (MAGE) class of NELs in cancer cells and acts as a 2-acetyl MAGE hydrolase and is likely the principal source for this activity in tumor cells(PMID:21513884). The full length protein has three glycosylation sites and can be N-glycosylated(PMID:19159218). It has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5136 Product name: Recombinant human AADACL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 83-435 aa of BC047588 Sequence: SHHLLALNFIIVSFGKKSAWSSAKVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYIMTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL Predict reactive species Full Name: arylacetamide deacetylase-like 1 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC047588 Gene Symbol: AADACL1 Gene ID (NCBI): 57552 RRID: AB_2034888 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PIU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924