Iright
BRAND / VENDOR: Proteintech

Proteintech, 14052-1-AP, CDK6 Polyclonal antibody

CATALOG NUMBER: 14052-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CDK6 (14052-1-AP) by Proteintech is a Polyclonal antibody targeting CDK6 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 14052-1-AP targets CDK6 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, C2C12 cells, MOLT-4 cells, NIH/3T3 cells, K-562 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human urothelial carcinoma tissue, human endometrial cancer tissue, human lung cancer tissue, mouse colon tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Cyclin-dependent kinase 6 (CDK6) is an enzyme belonging to the CDK family. CDK6 is a catalyticsubunit of aproteinkinase complex that is essential for progression through the G1 phase of thecell cycle and G1/S transition,thusactivating cell proliferation. CDK6 partners with cyclins tophosphorylate the retinoblastoma (pRb) protein toreleaseits binding partner E2F; a transcriptionfactor that drives gene expression necessary for DNA replication(PMID: 8114739). CDK6 was longthought of as a redundant homolog of CDK4 as they perform similar roles in cellcycle progression.But recently it has become apparent that CDK6 and CDK4 differ intissue-specific functions,whereCDK6 plays a role in differentiation (PMID: 16410727) but also in contribution to tumor development.What is the molecular weight of CDK6?The molecular weight of CDK6 is approximately 36-40 kDa (PMID: 23563707, 8114739).What is the subcellular localization of CDK6?CDK6 is ubiquitously expressed through the nucleus and cytoplasm. However, the most active complexes arelocatedin the nuclei of proliferating cells.What is the expression pattern of CDK6?CDK6 activity first occurs midway through the G1 phase. Its expression isregulated by D-typecyclins andmembersoftheINK4 family of CDK inhibitors (PMID: 7739547).What is CDK6's role in cancer?CDK6 is involved in a critical regulatory point in the cell cycle and so is found to be unbalanced in approximately80-90% of tumors (PMID: 23356980). Loss of cell cycle control is the initial step in the development ofthehallmarksof cancer, such as sustained proliferative signaling and dysregulated cellular energetics. Deregulationof CDK6 has animportant role in lymphoma by increasing angiogenesis (PMID: 23948297) and upregulated CDK6expression is alsoassociated with a poor clinical prognosis in medulloblastoma (PMID: 23172372). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5275 Product name: Recombinant human CDK6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-326 aa of BC027989 Sequence: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA Predict reactive species Full Name: cyclin-dependent kinase 6 Calculated Molecular Weight: 326 aa, 36 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC027989 Gene Symbol: CDK6 Gene ID (NCBI): 1021 RRID: AB_10642144 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00534 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924