Proteintech, 14064-1-AP, p38 MAPK Polyclonal antibody

Size: 20ul / 150ul The p38 MAPK (14064-1-AP) by Proteintech is a Polyclonal antibody targeting p38 MAPK in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14064-1-AP targets p38 MAPK in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, mouse heart tissue, RAW 264.7 cells, NIH/3T3 cells, rat spleen tissue, Neuro-2a cells, rat heart tissue, K-562 cells Positive IHC detected in: human colon cancer tissue, human liver cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cellself-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has some isoforms with MW 29-31 kDa, 35 kDa and 41 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, rabbit, chicken, zebrafish, goat, fish, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5115 Product name: Recombinant human p38 MAPK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-307 aa of BC031574 Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY Predict reactive species Full Name: mitogen-activated protein kinase 14 Calculated Molecular Weight: 360 aa, 41 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC031574 Gene Symbol: p38 MAPK Gene ID (NCBI): 1432 RRID: AB_2878007 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16539 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.