Iright
BRAND / VENDOR: Proteintech

Proteintech, 14072-1-AP, ZNF354A Polyclonal antibody

CATALOG NUMBER: 14072-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZNF354A (14072-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF354A in WB, ELISA applications with reactivity to human, mouse, rat samples 14072-1-AP targets ZNF354A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ZNF354A, also called EZNF, KID-1 or TCF17, belongs to the Kruppel C2H2-type zinc-finger family of proteins that contain KRAB domains and act as transcriptional regulators. Expressed primarily in the adult kidney, ZNF354A is a transcriptional repressor that plays a role in late renal development and is suppressed after renal ischemia. The N-terminus of ZNF354A contains the KRAB domain which confers transcriptional repressor activity, while the C-terminus contains multiple Cys2His2-zinc fingers. ZNF354A is located in the nucleolus and is thought to specifically influence development of the proximal tubule by shutting off dispensable or inhibitory genes. Reduced ZNF354A expression prevents proper cell differentiation and may, therefore, be implicated in renal carcinoma. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5142 Product name: Recombinant human ZNF354A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 257-605 aa of BC047105 Sequence: LIQHQITHTGEKPYICKECGKAFTLSTSLYKHLRTHTVEKSYSCKECGKSFSRRSGLFIHQKIHAEENPCKYNPGRKASSCSTSLSGCQRIHSRKKSYLCNECGNTFKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCNECGKGFTSISRLNRHRIIHTGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSALIQHQRMHTGERPYKCNECGKTFRCNSSLSNHQRIHTGEKPYRCEECGISFGQSSALIQHRRIHTGEKPFKCNTCGKTFRQSSSRIAHQRIHTGEKPYECNTCGKLFNHRSSLTNHYKIHIEEDP Predict reactive species Full Name: zinc finger protein 354A Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC047105 Gene Symbol: ZNF354A Gene ID (NCBI): 6940 RRID: AB_2217732 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60765 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924