Proteintech, 14074-1-AP, GNPTG Polyclonal antibody

Size: 20ul / 150ul The GNPTG (14074-1-AP) by Proteintech is a Polyclonal antibody targeting GNPTG in WB, ELISA applications with reactivity to human, mouse, rat samples 14074-1-AP targets GNPTG in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information GlcNAc-phosphotransferase is a multisubunit enzyme with an α2β2γ2 arrangement that requires a detergent for solubilization. Recent cloning of cDNAs and genes encoding these subunits revealed that the α- and β-subunits are encoded by a single gene as a precursor, whereas the γ-subunit is encoded by a second gene. Sugar composition and/ or additional modifications which alter the charge of the GNPTAG oligosaccharide chains are variable in a cell type-depending manner. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5153 Product name: Recombinant human GNPTG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 5-304 aa of BC014592 Sequence: LARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL Predict reactive species Full Name: N-acetylglucosamine-1-phosphate transferase, gamma subunit Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa, 68~70 kDa GenBank Accession Number: BC014592 Gene Symbol: GNPTG Gene ID (NCBI): 84572 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJJ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.