Proteintech, 14078-1-AP, GNL1 Polyclonal antibody

Size: 20ul / 150ul The GNL1 (14078-1-AP) by Proteintech is a Polyclonal antibody targeting GNL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 14078-1-AP targets GNL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, Raji cells, U-937 cells, K-562 cells, MCF-7 cells Positive IHC detected in: human heart tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Guanine nucleotide-binding protein-like 1 (GNL1), also known as HSR1, belongs to HSR1_MMR1 subfamily of nucleolar GTPases. It encodes 607 amino acids with a molecular mass of 69 kDa and contains basic amino acids rich N-terminus, acidic amino acids rich C-terminus and proline rich-domains. GNL1 plays a critical role in liver cell proliferation, but its function remains largely unknown (PMID: 18255255). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5203 Product name: Recombinant human GNL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 309-607 aa of BC018366 Sequence: EKIARDVAGATWGNGSGEEEEEEDGPAVLVEQQTDSAMEPTGPTQERYKDGVVTIGCVGFPNVGKSSLINGLVGRKVVSVSRTPGHTRYFQTYFLTPSVKLCDCPGLIFPSLLPRQLQVLAGIYPIAQIQEPYTAVGYLASRIPVQALLHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAANSLLRLAVDGRLSLCFHPPGYSEQKGTWESHPETTELVVLQGRVGPAGDEEEEEEEELSSSCEEEGEEDRDADEEGEGDEETPTSAPGSSLAGRNPYALLGEDEC Predict reactive species Full Name: guanine nucleotide binding protein-like 1 Calculated Molecular Weight: 607 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC018366 Gene Symbol: GNL1 Gene ID (NCBI): 2794 RRID: AB_10641989 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36915 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.