Iright
BRAND / VENDOR: Proteintech

Proteintech, 14087-1-AP, DOK2 Polyclonal antibody

CATALOG NUMBER: 14087-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DOK2 (14087-1-AP) by Proteintech is a Polyclonal antibody targeting DOK2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14087-1-AP targets DOK2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Docking protein 2 (Dok2) is an adapter protein which is involved in hematopoiesis. Dok2 is able to control Klf1 expression by transcriptional regulation through directly binding to its promoter region (PMID: 25075100). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5218 Product name: Recombinant human DOK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-412 aa of BC032623 Sequence: MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYAVPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK Predict reactive species Full Name: docking protein 2, 56kDa Calculated Molecular Weight: 412 aa, 45 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC032623 Gene Symbol: DOK2 Gene ID (NCBI): 9046 RRID: AB_2230792 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60496 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924