Proteintech, 14102-1-AP, CNOT7 Polyclonal antibody

Size: 20ul / 150ul The CNOT7 (14102-1-AP) by Proteintech is a Polyclonal antibody targeting CNOT7 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 14102-1-AP targets CNOT7 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Cnot7, Ccr4-Not complex 7, is a component of CCR4-NOT complex and known to be a transcription factor and a modulator of mRNA degradation in yeast. Mammalian Cnot7 interacts with Tob and its family members, which is known as an inhibitor of BMP signaling through interfering with the Smad system and is involved in bone metabolism [PMID:17451368]. It is one of at least 8 subunits that make up the CCR4-Not transcription complex, which is involved in negative regulation of the pol II directed transcription in yeast24 and may be involved inglobal gene regulation by modulation of TATAA-binding protein (TBP) activity [PMID:10880468]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5235 Product name: Recombinant human CNOT7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-285 aa of BC060852 Sequence: MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS Predict reactive species Full Name: CCR4-NOT transcription complex, subunit 7 Calculated Molecular Weight: 285 aa, 33 kDa Observed Molecular Weight: 33-35 kDa GenBank Accession Number: BC060852 Gene Symbol: CNOT7 Gene ID (NCBI): 29883 RRID: AB_2245087 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UIV1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.