Iright
BRAND / VENDOR: Proteintech

Proteintech, 14110-1-AP, POLG Polyclonal antibody

CATALOG NUMBER: 14110-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The POLG (14110-1-AP) by Proteintech is a Polyclonal antibody targeting POLG in WB, ELISA applications with reactivity to human samples 14110-1-AP targets POLG in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293T cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information POLG is the catalytic subunit of DNA polymerase gamma solely responsible for the replication of mitochondrial DNA (mtDNA). POLG replicates both heavy and light strands of the circular mtDNA genome using a single-stranded DNA template, RNA primers, and the four deoxyribonucleoside triphosphates as substrates (PMID:11477093; 11897778; 15917273; 19837034; 9558343). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5256 Product name: Recombinant human POLG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 888-1239 aa of BC042571 Sequence: GADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP Predict reactive species Full Name: polymerase (DNA directed), gamma Calculated Molecular Weight: 140 kDa Observed Molecular Weight: 130-150 kDa GenBank Accession Number: BC042571 Gene Symbol: POLG Gene ID (NCBI): 5428 RRID: AB_3669178 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P54098 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924