Iright
BRAND / VENDOR: Proteintech

Proteintech, 14125-1-AP, CDC26 Polyclonal antibody

CATALOG NUMBER: 14125-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CDC26 (14125-1-AP) by Proteintech is a Polyclonal antibody targeting CDC26 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14125-1-AP targets CDC26 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information CDC26, also named as ANAPC12, APC12 and C9orf17, is a component of the anaphase promoting complex/cyclosome (APC/C). CDC26 can be detected as 14 kDa and ~18 kDa (PMID: 15060174 /PMID: 10222126). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5276 Product name: Recombinant human CDC26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC066300 Sequence: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF Predict reactive species Full Name: cell division cycle 26 homolog (S. cerevisiae) Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC066300 Gene Symbol: CDC26 Gene ID (NCBI): 246184 RRID: AB_2878018 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NHZ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924