Proteintech, 14139-1-AP, ADAM12 Polyclonal antibody

Size: 20ul / 150ul The ADAM12 (14139-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM12 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 14139-1-AP targets ADAM12 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells, mouse heart tissue, rat brain tissue, MCF-7 cells Positive IP detected in: HeLa cells Positive IHC detected in: human placenta tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ADAM12, also named as MLTN and Meltrin-alpha, is involved in skeletal muscle regeneration, specifically at the onset of cell fusion. It is also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. ADAM12 is expressed in human malignant tumors(PMID:17355265). ADAM12's ability to degrade extracellular matrix components likely allows it to detach cancer cells from the basement membrane and assist them on their route to metastasis. But the protein's role not just as a biomarker of breast cancer but as a gateway to cancer cell migration is only now being understood. ADAM12 has 2 isoforms with the calculated molecular mass of 100 and 80 kDa, and this antibody can recognize all isoforms of ADAM12. ADAM12 has 4 forms: 120kDa full-length form, 90kd mature (processed form that lack the prodomain), 50-68kDa degradation product and 27kDa prodomain. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5206 Product name: Recombinant human ADAM12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-350 aa of BC060804 Sequence: VSLWNQGRADEVVSASVRSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTGHCYYHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELG Predict reactive species Full Name: ADAM metallopeptidase domain 12 Calculated Molecular Weight: 100 kDa Observed Molecular Weight: 90-100 kDa, 70-80 kDa GenBank Accession Number: BC060804 Gene Symbol: ADAM12 Gene ID (NCBI): 8038 RRID: AB_2289230 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43184 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.