Proteintech, 14147-1-AP, Frataxin Polyclonal antibody

Size: 20ul / 150ul The Frataxin (14147-1-AP) by Proteintech is a Polyclonal antibody targeting Frataxin in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14147-1-AP targets Frataxin in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, Jurkat cells, K-562 cells, Raji cells, mouse liver tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Frataxin (FXN), also named as FRDA, X25, m81-FXN, d-FXN, m78-FXN and i-FXN, belongs to the frataxin family. It promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. FXN may play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. FXN is cleaved to be 4 chains. FXN is expressed in the cytoplasm as a 210 amino acid (AA) precursor protein (pFXN; 23 KDa) that is translocated into mitochondria where it is processed by two consecutive steps into iFXN (FXN 42-210; 19 KDa) and finally mFXN (81-210; 14.2 KDa), which is functional. (PMID: 26704351, PMID: 26671574) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5316 Product name: Recombinant human FXN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC048097 Sequence: MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA Predict reactive species Full Name: frataxin Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 14-23 kDa GenBank Accession Number: BC048097 Gene Symbol: FXN Gene ID (NCBI): 2395 RRID: AB_2231876 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16595 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.