Proteintech, 14153-1-AP, IL-18BP Polyclonal antibody

Size: 20ul / 150ul The IL-18BP (14153-1-AP) by Proteintech is a Polyclonal antibody targeting IL-18BP in WB, ELISA applications with reactivity to human, mouse, rat samples 14153-1-AP targets IL-18BP in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information IL18BP, also named as adekinig-alfa, has 3 isoforms (Isoform A 21kd; B 12kd and D 17kd). Isoform A binds to IL-18 and inhibits its activity. IL18BP functions as an inhibitor of the early TH1 cytokine response. Highly glycosylated of IL18BP will migrate to be 40kd. A 58kd protein is IL18BP crosslinked IL18. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5335 Product name: Recombinant human IL-18BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-194 aa of BC044215 Sequence: ATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG Predict reactive species Full Name: interleukin 18 binding protein Calculated Molecular Weight: 194 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC044215 Gene Symbol: IL-18BP Gene ID (NCBI): 10068 RRID: AB_2918034 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95998 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.