Iright
BRAND / VENDOR: Proteintech

Proteintech, 14154-1-AP, LILRB2/CD85d Polyclonal antibody

CATALOG NUMBER: 14154-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LILRB2/CD85d (14154-1-AP) by Proteintech is a Polyclonal antibody targeting LILRB2/CD85d in WB, IF/ICC, ELISA applications with reactivity to human samples 14154-1-AP targets LILRB2/CD85d in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, THP-1 cells Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LILRB2 (Leukocyte immunoglobulin-like receptor subfamily B member 2), also known as ILT4, CD85d or MIR10, is a type I transmembrane glycoprotein that contains four extracellular immunoglobulin domains, a transmembrane domain, and three cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs) (PMID: 33928233). LILRB2 is mainly expressed in immunocytes including monocytes, macrophages, and dendritic cells, and transduces negative signals by its association with SHP-1 phosphatase via the ITIMs (PMID: 35717259). LILRB2 can interact with various ligands such as HLA-A, HLA-B, HLA-C, HLA-G, HLA-F, CD1c, CD1d, angiopoietin-like proteins (ANGPTLs), and SEMA4A. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5336 Product name: Recombinant human LILRB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-350 aa of BC036827 Sequence: GTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQ Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2 Calculated Molecular Weight: 598 aa, 65 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC036827 Gene Symbol: LILRB2 Gene ID (NCBI): 10288 RRID: AB_3669180 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N423 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924