Iright
BRAND / VENDOR: Proteintech

Proteintech, 14156-1-AP, SLC26A11 Polyclonal antibody

CATALOG NUMBER: 14156-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC26A11 (14156-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A11 in WB, IHC, ELISA applications with reactivity to human, mouse samples 14156-1-AP targets SLC26A11 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, unboiled mouse brain tissue, mouse kidney tissue, unboiled mouse kidney tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC26A11 is a sodium-independent sulfate transporter from high endothelial venules (PMID: 12626430). SLC26A11 exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC) (PMID: 12626430). SLC26A11 is critical for inhibitory transmission and contributes to locomotor coordination in Purkinje cells (PMID: 27390771). SLC26A11, a chloride transporter, localizes with the vacuolar H+-ATPase of A-intercalated cells of the kidney and can be detected at 72kDa (PMID: 21716257). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5338 Product name: Recombinant human SLC26A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 463-606 aa of BC035900 Sequence: MLLHSAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQKPGTQPYNIREDSILDQKVALLKA Predict reactive species Full Name: solute carrier family 26, member 11 Calculated Molecular Weight: 606 aa, 65 kDa Observed Molecular Weight: 65-72 kDa GenBank Accession Number: BC035900 Gene Symbol: SLC26A11 Gene ID (NCBI): 284129 RRID: AB_3085430 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WA9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924