Proteintech, 14160-1-AP, SLC25A45 Polyclonal antibody

Size: 20ul / 150ul The SLC25A45 (14160-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A45 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14160-1-AP targets SLC25A45 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, SH-SY5Y cells Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information SLC25A45 (solute carrier family 25 member 45) is a mitochondrial inner membrane transporter recently identified as essential for the import of methylated amino acids. Dias et al. (2025, Molecular Cell) demonstrated that SLC25A45 specifically mediates the mitochondrial uptake of dimethylarginine and trimethyllysine, but not their unmethylated counterparts. This selective transport enables mitochondria to metabolize trimethyllysine for de novo carnitine biosynthesis, linking SLC25A45 activity to fatty acid oxidation and methylated amino acid homeostasis. A naturally occurring human variant, R285C, enhances SLC25A45 stability by disrupting m-AAA protease-dependent degradation and is associated with altered plasma levels of methylated amino acids and deoxycarnitine. Functionally, SLC25A45 defines a key metabolic node coordinating methylated amino acid turnover, carnitine synthesis, and mitochondrial signaling, implicating it in cardiovascular, renal, and metabolic pathophysiology. (PMID: 41075794) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5342 Product name: Recombinant human SLC25A45 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-335 aa of BC041100 Sequence: DLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQNPSSATVLVAGGLCRHCFLGGSHALRRDQVPDADGWTETQSVPGDAGLHGEQHPAGRTGSLLPGGHHQQCPRLSRQCCHLPQLRISPPLVGMSPAAMPAAPHQAHGLEASLRLEARLKACKSVQEAQPFLTKVPPTRADLGWADTCGSRKPGACAASLCSWP Predict reactive species Full Name: solute carrier family 25, member 45 Calculated Molecular Weight: 335 aa, 36 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC041100 Gene Symbol: SLC25A45 Gene ID (NCBI): 283130 RRID: AB_2190339 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N413 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.