Iright
BRAND / VENDOR: Proteintech

Proteintech, 14163-1-AP, BET1L Polyclonal antibody

CATALOG NUMBER: 14163-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BET1L (14163-1-AP) by Proteintech is a Polyclonal antibody targeting BET1L in WB, IHC, ELISA applications with reactivity to human, mouse samples 14163-1-AP targets BET1L in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, MCF-7 cells Positive IHC detected in: human cervical cancer tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5351 Product name: Recombinant human GS15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC032779 Sequence: MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAHGVRVSVPCPSTTCCRACSVSFSTGAGGWSNHHFCVILLGFLP Predict reactive species Full Name: blocked early in transport 1 homolog (S. cerevisiae)-like Calculated Molecular Weight: 102 aa, 11 kDa Observed Molecular Weight: 13-15 kDa GenBank Accession Number: BC032779 Gene Symbol: BET1L Gene ID (NCBI): 51272 RRID: AB_2064737 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924