Iright
BRAND / VENDOR: Proteintech

Proteintech, 14170-1-AP, UGCGL1 Polyclonal antibody

CATALOG NUMBER: 14170-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UGCGL1 (14170-1-AP) by Proteintech is a Polyclonal antibody targeting UGCGL1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 14170-1-AP targets UGCGL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human pancreas cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UDP-glucose:glycoprotein glucosyltransferase 1 (UGCGL1) is a central quality control gatekeeper in the mammalian endoplasmic reticulum (ER) and serves as a folding sensor in the calnexin/calreticulin glycoprotein quality control cycle (PMID: 28425917). UGCGL1 acts as a checkpoint in the quality control of the MHC class I antigen presentation pathway (PMID: 21383159). Western blot analysis detected UGCGL1 at an apparent molecular mass of 170 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5369 Product name: Recombinant human UGCGL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1221-1531 aa of BC041098 Sequence: TEEVKQDKDDIINIFSVASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYKWPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPYGYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL Predict reactive species Full Name: UDP-glucose ceramide glucosyltransferase-like 1 Calculated Molecular Weight: 1531 aa, 175 kDa Observed Molecular Weight: 170 kDa GenBank Accession Number: BC041098 Gene Symbol: UGCGL1 Gene ID (NCBI): 56886 RRID: AB_1288973 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924