Iright
BRAND / VENDOR: Proteintech

Proteintech, 14198-1-AP, GFI1 Polyclonal antibody

CATALOG NUMBER: 14198-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GFI1 (14198-1-AP) by Proteintech is a Polyclonal antibody targeting GFI1 in WB, ELISA applications with reactivity to human, mouse, rat samples 14198-1-AP targets GFI1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HL-60 cells, mouse thymus tissue, PC-3 cells, Raji cells, RAW264.7 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information GFI is a transcriptional repressor that is transiently induced during T-cell differentiation. It has critical roles in enhancing T helper-2 (Th2) cell expansion and in repressing induction of Th17 and CD103-positive inducible regulatory T (Treg) cells [PMID: 19188499]. GFI1 transcriptional regulator oncoprotein plays a crucial role in hematopoietic, inner ear, and pulmonary neuroendocrine cell development and governs cell processes as diverse as self-renewal of hematopoietic stem cells, proliferation, apoptosis, differentiation, cell fate specification, and oncogenesis (PMID: 18805794). The calculated molecular weight of GFI1 protein is about 45 kDa, but the modification of ubiquitinated GIF1 protein is about 62-66 kDa (PMID: 12721361). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5401 Product name: Recombinant human GFI1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-422 aa of BC032751 Sequence: MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK Predict reactive species Full Name: growth factor independent 1 transcription repressor Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 62-66 kDa GenBank Accession Number: BC032751 Gene Symbol: GFI1 Gene ID (NCBI): 2672 RRID: AB_2109976 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99684 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924