Proteintech, 14212-1-AP, KChIP1 Polyclonal antibody

Size: 20ul / 150ul The KChIP1 (14212-1-AP) by Proteintech is a Polyclonal antibody targeting KChIP1 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human samples 14212-1-AP targets KChIP1 in WB, IHC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human cerebellum tissue, human brain tissue Positive IP detected in: fetal human brain tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Human K(v) channel interacting protein 1 (KCHIP1) is a new member of the neural calcium binding protein superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. KChIP1 is a neuronal calcium sensor protein that is predominantly expressed at GABAergic synapses and it has been related with modulation of K(+) channels, GABAergic transmission and cell death. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5432 Product name: Recombinant human KCNIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC050375 Sequence: MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM Predict reactive species Full Name: Kv channel interacting protein 1 Calculated Molecular Weight: 227 aa, 27 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC050375 Gene Symbol: KCNIP1 Gene ID (NCBI): 30820 RRID: AB_2265412 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZI2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.